PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr013437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 458aa    MW: 50768.5 Da    PI: 6.743
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr013437.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-182976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv++ +++G g+W++ ++  g++R++k+c++rw +yl
      Pbr013437.1 29 KGPWTPEEDQKLVEYLERYGHGSWRALPKLAGLNRCGKSCRLRWTNYL 76
                     79********************************************97 PP

2Myb_DNA-binding53.94.2e-1782127148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++ +lG++ W++Ia+ ++ gRt++++k++w+++l
      Pbr013437.1  82 RGNFSQEEEQTIINLHSLLGNK-WSAIASNLP-GRTDNEIKNFWNTHL 127
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.572476IPR017930Myb domain
SuperFamilySSF466892.81E-3127123IPR009057Homeodomain-like
SMARTSM007179.0E-162878IPR001005SANT/Myb domain
PfamPF002491.7E-172976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-253083IPR009057Homeodomain-like
CDDcd001672.56E-123176No hitNo description
PROSITE profilePS5129426.36777131IPR017930Myb domain
SMARTSM007178.1E-1781129IPR001005SANT/Myb domain
PfamPF002497.0E-1682127IPR001005SANT/Myb domain
CDDcd001673.14E-1284127No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2784131IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MMGRSSATAS AWCDDDQDEK SSTDTMIKKG PWTPEEDQKL VEYLERYGHG SWRALPKLAG  60
LNRCGKSCRL RWTNYLRPDI KRGNFSQEEE QTIINLHSLL GNKWSAIASN LPGRTDNEIK  120
NFWNTHLKKK LFQMGIDPVT HKPISTTGTN IDHHQYLMII NQILSSLAPQ LLAASSSSSS  180
CSSTSTCNPL MLNNPWEWDC INNINNNVNM NALLGLHLSD AKTEVLQTIL QQQLLSTGSS  240
PPNNNNYVEA ALNYLLGSSS YSYNNSVPDD HHQQICGQYH SHHHPQSFSV NIGAPVHTNT  300
QFSHLNIPNI IHKPPHLLEH DQKPLPVYVA SSAGPASNLI YTAGTMMNKI GQQLGGPSSG  360
SYSYVTPTVT SDHHQLPLLV PSPECSAANI NLMTGNKIVD TSTNNPNTNQ DHVISDPNSP  420
STSTTSTTFE AWGDLMDHHD ESTNHSYWKH IILDRKY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30291317108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009352079.10.0PREDICTED: protein ODORANT1-like
TrEMBLM5XFX01e-84M5XFX0_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2295744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.24e-71myb domain protein 9